Protein Info for Pf6N2E2_104 in Pseudomonas fluorescens FW300-N2E2

Annotation: Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 PF00005: ABC_tran" amino acids 29 to 168 (140 residues), 82.7 bits, see alignment E=6e-27 PF17912: OB_MalK" amino acids 242 to 290 (49 residues), 36.4 bits, see alignment 1.2e-12 PF08402: TOBE_2" amino acids 285 to 341 (57 residues), 21.5 bits, see alignment E=3.1e-08

Best Hits

Swiss-Prot: 38% identical to YURJ_BACSU: Uncharacterized ABC transporter ATP-binding protein YurJ (yurJ) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a3768)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YJA3 at UniProt or InterPro

Protein Sequence (369 amino acids)

>Pf6N2E2_104 Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3) (Pseudomonas fluorescens FW300-N2E2)
MAEIRLQNLAHSYTSTPAGPEDYAIREMNHIWEQGGAYALLGPSGCGKSTLLNIISGLLS
PSEGQVMFDSKVVNDLTPERRNIAQVFQFPVVYDTMTVFDNLAFPLRNQGMAEARIHTKV
QEIAEVLDLQNLLDKKARNLTADEKQKVSMGRGLVRDDVSAILFDEPLTVIDPHLKWKLR
RKLKQIHEQFNITMVYVTHDQLEASTFADKIAVMYGGQIVQFGTPRDLFERPSHTFVGYF
IGSPGMNLIEVTAQPGGVGFASTHLPLSETLQRRVAEAEGKSLKVGIRPEFVHVWDGPYD
DAMQADVVHVEDLGTYKILTLNLDGVPLKVRLAEDKPVPEGTAYISFPGQWLMVYADEYL
LEPLSEVQP