Protein Info for Pf6N2E2_1005 in Pseudomonas fluorescens FW300-N2E2

Annotation: Ribose ABC transport system, periplasmic ribose-binding protein RbsB (TC 3.A.1.2.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 36 to 251 (216 residues), 61.3 bits, see alignment E=1.6e-20 PF13407: Peripla_BP_4" amino acids 37 to 289 (253 residues), 207 bits, see alignment E=5.7e-65 PF13377: Peripla_BP_3" amino acids 154 to 297 (144 residues), 41 bits, see alignment E=3.2e-14

Best Hits

Swiss-Prot: 30% identical to RBSB_SALTI: Ribose import binding protein RbsB (rbsB) from Salmonella typhi

KEGG orthology group: K10439, ribose transport system substrate-binding protein (inferred from 52% identity to azl:AZL_b01020)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZV81 at UniProt or InterPro

Protein Sequence (317 amino acids)

>Pf6N2E2_1005 Ribose ABC transport system, periplasmic ribose-binding protein RbsB (TC 3.A.1.2.1) (Pseudomonas fluorescens FW300-N2E2)
MKAQKGGLLCSAVLAAGLTFQLSPAFAAGEKILINFQTLSIPYFIYMHEQASQEAKVLNV
ELLVQDAQSSSTKQSSDVENALTQGVDAMVVAPNDVTALAPALNEVLSEKVPLVTVDRRV
EGTDTPVPYVTADSVAGGRLMAELVTSNMKNGARVAFIGGTPGSSTAIDRAKGVHEGLKA
GGGKFQLVAEQSGEWERAKAMSVAENILTSLSANPPDAIICASGDMALGAAEAVRATGLK
GKVKVIGFDAYPEVLRAIRDGDIAGIVEQSPSKQIRTALRMAVKKVRGEGELETVIVQPF
MITPENLSQAEQYSAIQ