Protein Info for Pf6N2E2_1 in Pseudomonas fluorescens FW300-N2E2

Annotation: Trans-aconitate 2-methyltransferase (EC 2.1.1.144)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF13489: Methyltransf_23" amino acids 15 to 143 (129 residues), 58.8 bits, see alignment E=1.7e-19 PF01135: PCMT" amino acids 30 to 140 (111 residues), 20.7 bits, see alignment E=9.2e-08 PF13847: Methyltransf_31" amino acids 31 to 144 (114 residues), 57.3 bits, see alignment E=4.7e-19 PF13649: Methyltransf_25" amino acids 34 to 123 (90 residues), 59.3 bits, see alignment E=1.5e-19 PF08242: Methyltransf_12" amino acids 35 to 125 (91 residues), 56.3 bits, see alignment E=1.4e-18 PF08241: Methyltransf_11" amino acids 36 to 127 (92 residues), 53.8 bits, see alignment E=7.4e-18

Best Hits

Swiss-Prot: 56% identical to TAM_METNO: Trans-aconitate 2-methyltransferase (tam) from Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)

KEGG orthology group: K00598, trans-aconitate 2-methyltransferase [EC: 2.1.1.144] (inferred from 95% identity to pba:PSEBR_a3924)

Predicted SEED Role

"Trans-aconitate 2-methyltransferase (EC 2.1.1.144)" (EC 2.1.1.144)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.144

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YGA8 at UniProt or InterPro

Protein Sequence (256 amino acids)

>Pf6N2E2_1 Trans-aconitate 2-methyltransferase (EC 2.1.1.144) (Pseudomonas fluorescens FW300-N2E2)
MGWSAKQYVTFEQERTRPSRDLLAAIPPTQARSVIDLGCGPGNSTELLVEHFSGATVRGL
DSSSDMVEAARKRLPAVAFDTADISQWDEPGPFDVIFANAVLQWLPDHATLLPSLVGKLA
PGGSLAIQMPDTLHQPSHRLMREIAANGPWASQLAGAGDSRTEVEDASTYYAILKPHCSR
VDVWRTTYHHPLAGGAAGVVEWFKGSGLRPFLEPLDEAQREQYLAQYLKAIEQAYPALDD
GTVLLPFPRVFMVATR