Protein Info for Pf1N1B4_735 in Pseudomonas fluorescens FW300-N1B4

Annotation: Electron transport complex protein RnfB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 TIGR01944: electron transport complex, RnfABCDGE type, B subunit" amino acids 2 to 132 (131 residues), 214.9 bits, see alignment E=3.6e-68 PF04060: FeS" amino acids 11 to 42 (32 residues), 45.7 bits, see alignment 1.1e-15 PF14697: Fer4_21" amino acids 74 to 128 (55 residues), 67.3 bits, see alignment E=2.6e-22 PF00037: Fer4" amino acids 75 to 96 (22 residues), 25.8 bits, see alignment (E = 1.8e-09) PF13237: Fer4_10" amino acids 75 to 122 (48 residues), 29.1 bits, see alignment 2.1e-10

Best Hits

KEGG orthology group: K03616, electron transport complex protein RnfB (inferred from 82% identity to pba:PSEBR_a4382)

Predicted SEED Role

"Electron transport complex protein RnfB" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166MT93 at UniProt or InterPro

Protein Sequence (335 amino acids)

>Pf1N1B4_735 Electron transport complex protein RnfB (Pseudomonas fluorescens FW300-N1B4)
MSLIQRIDALLPQTQCGKCGHPGCKPYAEGIASGEPINKCPPGGSETIAALADLLKVPVL
ELDVSRGSAPAQIAYIREAECIGCTKCIQACPVDAIVGAAKFMHTVIVDECTGCDLCVAP
CPVDCIEMHPLPLATVLPIVGGLAFSLEEQQARAAKRNHARRRFEQRNARLHREEEQKLA
ERQARAQRAVQHSEVTLDPVQAALERVRAQKAANADAALKKAKVDLAMSRAQLNKSLKAF
GHPPTFEQQSQLIVLQQQFEAAEQALAQLESSPPPVSAPPAPAKDAELKRAKIQLAMRRA
ELKKAQTSEAPAEQIEALQHALSEAERQVDAYAAP