Protein Info for Pf1N1B4_630 in Pseudomonas fluorescens FW300-N1B4

Annotation: TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF16331: TolA_bind_tri" amino acids 36 to 90 (55 residues), 34.6 bits, see alignment E=6.1e-12 PF13512: TPR_18" amino acids 133 to 223 (91 residues), 22.4 bits, see alignment E=4.9e-08 TIGR02795: tol-pal system protein YbgF" amino acids 134 to 251 (118 residues), 136.7 bits, see alignment E=2.9e-44 PF13525: YfiO" amino acids 135 to 224 (90 residues), 37.1 bits, see alignment E=1.2e-12 PF13432: TPR_16" amino acids 138 to 205 (68 residues), 38.5 bits, see alignment E=5.3e-13 PF13174: TPR_6" amino acids 139 to 167 (29 residues), 16.7 bits, see alignment (E = 3.6e-06) amino acids 173 to 203 (31 residues), 17.9 bits, see alignment 1.5e-06 amino acids 209 to 240 (32 residues), 20.5 bits, see alignment 2.2e-07

Best Hits

Swiss-Prot: 80% identical to CPOB_PSEPK: Cell division coordinator CpoB (cpoB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 91% identity to pba:PSEBR_c2g93)

Predicted SEED Role

"TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166MRA3 at UniProt or InterPro

Protein Sequence (254 amino acids)

>Pf1N1B4_630 TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain (Pseudomonas fluorescens FW300-N1B4)
VVEDNSGYNNSGSSYPPAGYGTNGAYAGGGVSAPVSAQGELFNQLQSMQEQISRQQGVIE
VLQNDVARMKQENLERYQDLDRRIGTGVAPAATPDNSSTGGNLNAPGAAAGADAGAAAAQ
APAAGGEPADPAKEKLYYDAAFDLIKAKDFDKASQAFAAFLRKYPNSQYAGNAQYWLGEV
NLAKGDLQGAGQAFAKVSQLYPKHPKVPDSLYKLADVERRLGHTDRVKGILQQVVSQYPG
TSAAQLAQRDLQRM