Protein Info for Pf1N1B4_5760 in Pseudomonas fluorescens FW300-N1B4

Annotation: Nitric-oxide reductase subunit C (EC 1.7.99.7)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 transmembrane" amino acids 68 to 87 (20 residues), see Phobius details PF13442: Cytochrome_CBB3" amino acids 107 to 185 (79 residues), 26.6 bits, see alignment E=6.4e-10 PF00034: Cytochrom_C" amino acids 107 to 188 (82 residues), 55.9 bits, see alignment E=9.3e-19

Best Hits

Predicted SEED Role

"Nitric-oxide reductase subunit C (EC 1.7.99.7)" in subsystem Denitrification (EC 1.7.99.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.99.7

Use Curated BLAST to search for 1.7.99.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (202 amino acids)

>Pf1N1B4_5760 Nitric-oxide reductase subunit C (EC 1.7.99.7) (Pseudomonas fluorescens FW300-N1B4)
LLTDTPPSRASPLPHSISVSHTIYTRPKPSAFLDRHQAGFNPSLSIMGTPSKEEATMSET
FTKGMARNIYFGGSIFFFLIFLALTYHTEQTFPVRSNEAQLTESVIRGKTVWEQNNCIGC
HTLLGEGAYFAPELGNVFQRRGGEAGFKPFLHAWMKMQPLGVPGRRAMPQFKLSEQEVDD
IAEFLKWSSNINTNNWPPNKEG