Protein Info for Pf1N1B4_5741 in Pseudomonas fluorescens FW300-N1B4

Annotation: Nitrate/nitrite response regulator protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 PF00072: Response_reg" amino acids 9 to 120 (112 residues), 107.6 bits, see alignment E=4.1e-35 PF00196: GerE" amino acids 153 to 207 (55 residues), 71.8 bits, see alignment E=2.8e-24

Best Hits

Swiss-Prot: 53% identical to NARL_ECO57: Nitrate/nitrite response regulator protein NarL (narL) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 92% identity to pba:PSEBR_a3152)

MetaCyc: 53% identical to DNA-binding transcriptional dual regulator NarL (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Nitrate/nitrite response regulator protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161XGM4 at UniProt or InterPro

Protein Sequence (215 amino acids)

>Pf1N1B4_5741 Nitrate/nitrite response regulator protein (Pseudomonas fluorescens FW300-N1B4)
MTPSPQHRILLVDDHPMMRHGIRQMLELEDDFLIVGEASQGEEALGLIEPLRPDLVLLDN
NMPQMNGIETLRRLRAMHYTGKVLLFTVSDAEDDIRDALRLDADGYLLKDMEPELLIQYI
RDALNGALVISPGLTQVMAQALRAPARQAVVELTERERQVLKTIASGFSNKVIGHKLGIT
EGTVKVHVKNLLHKLGLRSRVEAAVWAMEHLRSAG