Protein Info for Pf1N1B4_4902 in Pseudomonas fluorescens FW300-N1B4

Annotation: ABC-type protease exporter, membrane fusion protein (MFP) family component PrtE/AprE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 30 to 449 (420 residues), 365.4 bits, see alignment E=2.2e-113 PF13533: Biotin_lipoyl_2" amino acids 73 to 116 (44 residues), 40 bits, see alignment 6.8e-14 PF00529: CusB_dom_1" amino acids 125 to 405 (281 residues), 52.7 bits, see alignment E=8.6e-18 PF13437: HlyD_3" amino acids 301 to 403 (103 residues), 45.2 bits, see alignment E=3.4e-15

Best Hits

Swiss-Prot: 50% identical to APRE_PSEAE: Alkaline protease secretion protein AprE (aprE) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K12537, protease secretion protein HasE (inferred from 93% identity to pfo:Pfl01_2681)

Predicted SEED Role

"ABC-type protease exporter, membrane fusion protein (MFP) family component PrtE/AprE" in subsystem Protein secretion by ABC-type exporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166QB78 at UniProt or InterPro

Protein Sequence (449 amino acids)

>Pf1N1B4_4902 ABC-type protease exporter, membrane fusion protein (MFP) family component PrtE/AprE (Pseudomonas fluorescens FW300-N1B4)
MSSTRMNDDSEATMEHDYIAERPERDARFFARMGWILAIVGAGSFFTWASLAPLDQGIPV
QGTVVVSGKRKAVQSMSSGVVSQILVREGQVVKQGQPLFRLDQTQVAADVQSLQAQYRMA
WASLARWQSERDNLKQVNFPAELSNDPDPRLALVLEGQRQLFSSRREAFSREQAALRANI
EGASAQLAGMRRARIDLTAQASSLQQQLSNLQPLADNGYIPRNRLMDYQRQLSQVQQQLA
ENSGESGRVEQGILESRLKLQQHSEEYQKEVRSQLADAQLKSVTLEEQLTSAGFDLQHSE
IIATADGIAVNLGVHTEGAVVRQGDTLLEIVPQGTRLEVEGHLPINLIDKVGTHLPVDIL
FTAFNQSRTPRVPGEVSLISADQMVDEKTGVPYYVLRSSVSDQAMEKLNGLVIKPGMPAE
MFVRTGERSLLNYLFKPLLDRAGSALTEE