Protein Info for Pf1N1B4_4846 in Pseudomonas fluorescens FW300-N1B4

Annotation: Multiple polyol-specific dehydrogenase (EC 1.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01232: Mannitol_dh
  • amino acids 28 to 192 (165 residues), 161.5 bits, E=1.8e-51
• PF08125: Mannitol_dh_C
  • amino acids 221 to 458 (238 residues), 257.5 bits, E=1.3e-80

Best Hits

Swiss-Prot: 44% identical to POR_GLUOX: Polyol:NADP oxidoreductase (por) from Gluconobacter oxydans (strain 621H)

KEGG orthology group: None (inferred from 91% identity to pfo:Pfl01_2636)

MetaCyc: 42% identical to D-mannonate oxidoreductase (Escherichia coli K-12 substr. MG1655)
Fructuronate reductase. [EC: 1.1.1.57]

Predicted SEED Role

"Multiple polyol-specific dehydrogenase (EC 1.1.1.-)" in subsystem Mannitol Utilization or Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 1.1.1.-)

MetaCyc Pathways

• mannitol cycle (4/5 steps found)
• D-fructuronate degradation (3/4 steps found)
• superpathway of β-D-glucuronosides degradation (4/7 steps found)
• superpathway of hexuronide and hexuronate degradation (4/10 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (14/31 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Fructose and mannose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Pentose and glucuronate interconversions
• Polyketide sugar unit biosynthesis
• Retinol metabolism
• Tetrachloroethene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.- or 1.1.1.57

Sequence Analysis Tools

See A0A166QA49 at UniProt or InterPro

Protein Sequence (491 amino acids)

>Pf1N1B4_4846 Multiple polyol-specific dehydrogenase (EC 1.1.1.-) (Pseudomonas fluorescens FW300-N1B4)
MKLNKQNLNRLAPEVALPAYTLSDTRQGIAHIGVGGFHRAHQAYYTDALMNTGEALDWAI
CGVGLRAEDRRARDDLKEQDYLFTLFELGDADDAEVRVIGAIRDMLLAEDSPEVLIDKLA
DPDIRIVSLTITEGGYCIDDSNGEFMAHLPQIQHDLAHPNAPKTVFGFLCAALAKRRAAG
TPAFTLMSCDNLPHNGAVTRKALLAFAALRDADLRDWIERHVSFPNAMVDRITPMTSTEH
RLQLHDKHSIDDAWPVVCEPFVQWVLEDKFVNGRPAWEKVGVQFTDDVTPYEEMKIKLLN
GSHLALTYLGFLKGYRFVHETMNDPLFVRYMRAYMDLDVTPQLAPVPGIDLTEYKNTLVA
RFSNQAIADQLERVCSDGSSKFPKFTVPTINCLIADGQETKRAALVVAAWALYLKGVDEN
GQTYAIPDPRAAFCQALVADDVLITQRLLEVEEIFGTAIPRSPEFVAAFEWCCNSLREVG
VTRTLERVLAA