Protein Info for Pf1N1B4_4426 in Pseudomonas fluorescens FW300-N1B4

Annotation: Glutamate transport membrane-spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 35 to 61 (27 residues), see Phobius details amino acids 82 to 105 (24 residues), see Phobius details amino acids 110 to 120 (11 residues), see Phobius details amino acids 155 to 173 (19 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details amino acids 209 to 230 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 30 to 132 (103 residues), 63 bits, see alignment E=1.5e-21 PF00528: BPD_transp_1" amino acids 52 to 238 (187 residues), 62.3 bits, see alignment E=2.5e-21

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 94% identity to pfs:PFLU2234)

Predicted SEED Role

"Glutamate transport membrane-spanning protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166Q0Z3 at UniProt or InterPro

Protein Sequence (244 amino acids)

>Pf1N1B4_4426 Glutamate transport membrane-spanning protein (Pseudomonas fluorescens FW300-N1B4)
MSHLLELFVHWAAGFGLNYGFLLDAYQRGTLEQGALTTVLLCLFTIVGSLLAGVGLAAML
TSGNPWLAKPARVFIEVTRNTPTLVQLYCAFLVLNMLLTQAVGAANPLTPFAWVVIVISL
HKGAFHAEALRAGIEAVPAVTMEAASSLAFSSRQLLWNVQLPLALRFALPSLINNLIDLV
KMTAVASAIAVGDITYAAIMIWTQSDNVLELMILILTFFGLLSFTVNCVGRLLEARLRMP
GYGH