Protein Info for Pf1N1B4_4360 in Pseudomonas fluorescens FW300-N1B4

Annotation: Phosphoglycolate phosphatase (EC 3.1.3.18)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 PF00702: Hydrolase" amino acids 4 to 179 (176 residues), 77.9 bits, see alignment E=2.7e-25 PF13419: HAD_2" amino acids 6 to 185 (180 residues), 116.7 bits, see alignment E=2.7e-37 PF12710: HAD" amino acids 6 to 176 (171 residues), 41.7 bits, see alignment E=3.7e-14 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 102 to 179 (78 residues), 28.5 bits, see alignment E=1.8e-10 PF13242: Hydrolase_like" amino acids 142 to 198 (57 residues), 36.9 bits, see alignment E=5.5e-13

Best Hits

Swiss-Prot: 35% identical to GPH_XANCP: Phosphoglycolate phosphatase (gph) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 56% identity to pen:PSEEN0963)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166PZP3 at UniProt or InterPro

Protein Sequence (234 amino acids)

>Pf1N1B4_4360 Phosphoglycolate phosphatase (EC 3.1.3.18) (Pseudomonas fluorescens FW300-N1B4)
LRVEAVLFDLDGTLVDTLPDITWCLNQVLLEHGCPAQSAETVRGYIGGGVTAMIEQVATR
FGIADAAALHQRYVALYQNNLVQFSRPFSGVLALLEGCRQLQVPLAIVTNKTEEMALQVA
DALLPQNTFGAILGHRAGRALKPQPEVAWEAARRLSIDPQRCLFVGDTEIDLKTARAAGM
YSAAVTWGYGLTPDLQALAPNICCEQPAGLLRILRQVCGTAHAFTEHGDTVKSY