Protein Info for Pf1N1B4_4258 in Pseudomonas fluorescens FW300-N1B4

Annotation: Ribonucleotide reductase, alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 79 TIGR02448: conserverd hypothetical protein" amino acids 3 to 79 (77 residues), 110.9 bits, see alignment E=1.6e-36 PF09498: DUF2388" amino acids 9 to 78 (70 residues), 111.2 bits, see alignment E=1e-36

Best Hits

Predicted SEED Role

"Ribonucleotide reductase, alpha subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166QJH1 at UniProt or InterPro

Protein Sequence (79 amino acids)

>Pf1N1B4_4258 Ribonucleotide reductase, alpha subunit (Pseudomonas fluorescens FW300-N1B4)
MADVEAKDVATSAGISASLYSTFKDDKIVIPARDDASSFVASGGTIRGAYLESVLKQIRQ
DHPDLQASDEDLAKAILAQ