Protein Info for Pf1N1B4_418 in Pseudomonas fluorescens FW300-N1B4

Annotation: Molybdenum cofactor biosynthesis protein MoaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 PF04055: Radical_SAM" amino acids 15 to 174 (160 residues), 96.5 bits, see alignment E=3e-31 PF06463: Mob_synth_C" amino acids 181 to 307 (127 residues), 96.2 bits, see alignment E=2.3e-31

Best Hits

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 96% identity to pba:PSEBR_a4041)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166MLR8 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Pf1N1B4_418 Molybdenum cofactor biosynthesis protein MoaA (Pseudomonas fluorescens FW300-N1B4)
MIVDRQGRRFRNLRISLTSACNYACTYCVPNGKRLVAAQDELSAEAMARGVAYLIEAAGI
ERLRITGGEPLVSPKLEAFMTAVGQMGLADISLTTNGQLLAKKLPLLVDAGIRRINVSLD
TLDASAFRSIARGGDLATVLNGMDQAAAAGMKIKVNMVPLRGQNLDQVMPLLDYCLERGY
ELRFIELMRMGHLASDSNAFLQQFVSLQQLLSLIGERYEYLQADAPVDATAVRYQIPGLG
HFGVIANESVPFCRTCSRLRLSSTGWLHGCLSSSNRHYVGDLLDKPRHQALPALQRLLVK
ALGDKQEVAFSGGATIMKIIGG