Protein Info for Pf1N1B4_3264 in Pseudomonas fluorescens FW300-N1B4

Annotation: Methyltransferase (EC 2.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 PF13679: Methyltransf_32" amino acids 167 to 303 (137 residues), 112.5 bits, see alignment E=3.3e-36 PF01135: PCMT" amino acids 180 to 257 (78 residues), 20.4 bits, see alignment E=7.6e-08 PF13847: Methyltransf_31" amino acids 191 to 273 (83 residues), 35.9 bits, see alignment E=1.3e-12

Best Hits

KEGG orthology group: None (inferred from 91% identity to pba:PSEBR_a1296)

Predicted SEED Role

"Methyltransferase (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166P7H8 at UniProt or InterPro

Protein Sequence (404 amino acids)

>Pf1N1B4_3264 Methyltransferase (EC 2.1.1.-) (Pseudomonas fluorescens FW300-N1B4)
MSVTATPASLAPDHHAQFIDLLQTSLDQNAFIKLVLAKYVGGEADLQRLIIKQLTVKDQP
CLSFVYRYKTRDITKNLPITEGVATIAALLPASFKNAHLLSLTDEAQLEYSKKGKSSLFK
SKPQQLREVPSAEHNREKNRFLDLSRPFLKDLGVTNAQHELIPAMSRKWKQINKFIEVFS
HALTSSPLALDKPVRVADFGSGKGYLTFAIHDYLRNTLKAEGEVTGVELREDMVSLCNTA
AAKLEHPGLVFKCGDVRSVAPSELDVMIALHACDIATDYAIHTGIRSGASIIMCSPCCHK
QIRLQIQSPALLKPMLQYGLHLGQQAEMVTDSLRALFLEACGYETKVFEFISLDHTNKNK
MILAVKRAEPVDPAQLLVKIQELKDFYHISEHCLETLLRADGYL