Protein Info for Pf1N1B4_2299 in Pseudomonas fluorescens FW300-N1B4

Annotation: probable integral membrane protein NMA1899

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 transmembrane" amino acids 71 to 92 (22 residues), see Phobius details amino acids 103 to 127 (25 residues), see Phobius details amino acids 170 to 196 (27 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 255 to 280 (26 residues), see Phobius details PF11067: DUF2868" amino acids 145 to 442 (298 residues), 352.4 bits, see alignment E=1.4e-109

Best Hits

KEGG orthology group: None (inferred from 84% identity to pfo:Pfl01_5362)

Predicted SEED Role

"probable integral membrane protein NMA1899"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166NNJ6 at UniProt or InterPro

Protein Sequence (459 amino acids)

>Pf1N1B4_2299 probable integral membrane protein NMA1899 (Pseudomonas fluorescens FW300-N1B4)
VTELTPLQNLWLSETIRLREEHAGPLDDLEANRIARSAGGDLPTRIQRRALWLAERDGQT
RALKHWLQGARLALIVLAVLAVISGAGLAFAALGDGQTPVNVFWALGSLLGLNLILLLSW
ALGLVFAGEQGAALGRLWLWLSEKLARDANAAQLAPALLLLLQRQKLNRWALGVLVNGLW
LLAMLSALVMVLTLMATRRYGFVWETTILGGDTFVAMTQALGALPALLGFSVPSAEMIRA
SGDAALNIESARQAWAAWLVGVLLVYGVLPRLLLALFCLWRWKTGQAALHLNLNLPGYAQ
LRERLMPTSERLGISDAAPEQLHRVEKTASDLQSDGALLVAIELDDQRPWPPQLPKNVNN
AGVLDSRESRHKLLEQLSRFPPARLAIACDPRRSPDRGSLALIAELSRSATATRVWLLQA
PPGEALDAERLGDWHVALQQLDLPFADCAPLNWLETGHD