Protein Info for Pf1N1B4_1008 in Pseudomonas fluorescens FW300-N1B4

Annotation: FIG006045: Sigma factor, ECF subfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 12 to 156 (145 residues), 67.2 bits, see alignment E=6.9e-23 PF04542: Sigma70_r2" amino acids 12 to 77 (66 residues), 58.3 bits, see alignment E=1.6e-19 PF07638: Sigma70_ECF" amino acids 35 to 156 (122 residues), 30.8 bits, see alignment E=8.4e-11 PF08281: Sigma70_r4_2" amino acids 108 to 160 (53 residues), 57.9 bits, see alignment E=1.9e-19 PF04545: Sigma70_r4" amino acids 113 to 160 (48 residues), 27.7 bits, see alignment E=4.5e-10

Best Hits

Swiss-Prot: 51% identical to FECI_ECOLI: Probable RNA polymerase sigma factor FecI (fecI) from Escherichia coli (strain K12)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 87% identity to pfo:Pfl01_0925)

MetaCyc: 51% identical to RNA polymerase sigma factor FecI (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"FIG006045: Sigma factor, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166MYG1 at UniProt or InterPro

Protein Sequence (164 amino acids)

>Pf1N1B4_1008 FIG006045: Sigma factor, ECF subfamily (Pseudomonas fluorescens FW300-N1B4)
VPLSSATTVEVLYHAHHNWLTGWLRRKLGCPDSAADLAQDTFIRVLTARETPQIIEPRAF
LTTIAKRVLFNHYRRQDLERAYLDALAQMPEIVAPSEEDRAIILQTLMELDQLLDGLPRL
VKRAFLLAQLDGLTYPQIAAELGISIATVKRHLNKAAMRCYFAR