Protein Info for PFLU_RS29590 in Pseudomonas fluorescens SBW25-INTG

Annotation: serine/threonine-protein phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 PF13672: PP2C_2" amino acids 17 to 200 (184 residues), 34.2 bits, see alignment E=1.9e-12 PF00481: PP2C" amino acids 28 to 136 (109 residues), 23.3 bits, see alignment E=4.7e-09

Best Hits

KEGG orthology group: K11915, serine/threonine protein phosphatase Stp1 [EC: 3.1.3.16] (inferred from 100% identity to pfs:PFLU6011)

Predicted SEED Role

"Phosphoprotein phosphatase PppA"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.16

Use Curated BLAST to search for 3.1.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K499 at UniProt or InterPro

Protein Sequence (239 amino acids)

>PFLU_RS29590 serine/threonine-protein phosphatase (Pseudomonas fluorescens SBW25-INTG)
MGSTYKSASKSHVGMVRQVNEDACLDLPENRLWVVADGMGGHAAGDYVSSLIVDSLRSVP
VGRSLDEYTAALRNDLIRINAAVREETAHRGVSMMGSTVVLLAARGLRGVCLWAGDSRLY
RLRDGVLEGISRDHSYVQDLQDSGLLSEADARVHPRANIVTRAIGVEAHLDLAVVDLLIA
PGDSYLLCSDGLNKTVEDHEIREVLSHDAPDEIVRSLVHLGLNRGAPDNITAIVVKVSP