Protein Info for PFLU_RS28375 in Pseudomonas fluorescens SBW25-INTG

Annotation: pyrroline-5-carboxylate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03807: F420_oxidored
  • amino acids 5 to 99 (95 residues), 77.6 bits, E=1.9e-25
• PF03446: NAD_binding_2
  • amino acids 5 to 96 (92 residues), 25.3 bits, E=2.9e-09
• TIGR00112: pyrroline-5-carboxylate reductase
  • amino acids 6 to 266 (261 residues), 266.5 bits, E=1.5e-83
• PF01210: NAD_Gly3P_dh_N
  • amino acids 46 to 106 (61 residues), 27.7 bits, E=5.1e-10
• PF14748: P5CR_dimer
  • amino acids 162 to 266 (105 residues), 126.2 bits, E=1.3e-40

Best Hits

Swiss-Prot: 71% identical to P5CR_PSEAE: Pyrroline-5-carboxylate reductase (proC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00286, pyrroline-5-carboxylate reductase [EC: 1.5.1.2] (inferred from 100% identity to pfs:PFLU5764)

MetaCyc: 42% identical to pyrroline-5-carboxylate reductase (Hordeum vulgare)
Pyrroline-5-carboxylate reductase. [EC: 1.5.1.2]

Predicted SEED Role

"Pyrroline-5-carboxylate reductase (EC 1.5.1.2)" in subsystem Proline Synthesis (EC 1.5.1.2)

MetaCyc Pathways

• L-arginine degradation XIII (reductive Stickland reaction) (5/5 steps found)
• L-arginine degradation VI (arginase 2 pathway) (4/4 steps found)
• L-proline biosynthesis I (from L-glutamate) (4/4 steps found)
• L-proline biosynthesis III (from L-ornithine) (3/3 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.2

Sequence Analysis Tools

See C3K3K8 at UniProt or InterPro

Protein Sequence (272 amino acids)

>PFLU_RS28375 pyrroline-5-carboxylate reductase (Pseudomonas fluorescens SBW25-INTG)
MSNTRIAFIGAGNMAASLIGGLRAKGLGAAQIRASDPGADTRARVSAEHGIETFADNAEA
IRGVDVIVLAVKPQAMKAVCESLRPSLQPQQLVVSIAAGITCASMNNWLGAQPIVRCMPN
TPALVSQGVSGLYATAEVSAEQRNQAQALLSAVGTALWLEHEQQLDAVTAVSGSGPAYFF
LLIEAMTAAGVKLGLSKDVAEQLAEQTALGAAHMAVASDVDAAELRRRVTSPGGTTQAAI
ESFQAGGFEALVEKALSAAAHRSAELAEQLGK