Protein Info for PFLU_RS27695 in Pseudomonas fluorescens SBW25-INTG

Annotation: CBS domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 657 PF00027: cNMP_binding" amino acids 63 to 150 (88 residues), 32.5 bits, see alignment E=1.4e-11 PF00571: CBS" amino acids 193 to 247 (55 residues), 44.6 bits, see alignment 3e-15 amino acids 261 to 308 (48 residues), 32.5 bits, see alignment 1.7e-11 PF03445: DUF294" amino acids 336 to 475 (140 residues), 142.3 bits, see alignment E=1.9e-45 PF10335: DUF294_C" amino acids 512 to 655 (144 residues), 147.2 bits, see alignment E=5.9e-47

Best Hits

KEGG orthology group: K07182, CBS domain-containing protein (inferred from 100% identity to pfs:PFLU5625)

Predicted SEED Role

"Predicted signal-transduction protein containing cAMP-binding and CBS domains" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K373 at UniProt or InterPro

Protein Sequence (657 amino acids)

>PFLU_RS27695 CBS domain-containing protein (Pseudomonas fluorescens SBW25-INTG)
MKDDNDKKIAVTVMSKADAFAQAGKTAVLQNIHGTLQFLQRFPPFNQMENAHLAFLVEQC
QLRFYGPGESILKPSGGPVEHFYIVKQGRVVGERPVANQETAETTFEITTGECFPLAALL
GERATRTEHKAAEDTFCLQLNKPAFIKLFALSSPFRDFALRGVSSLLDQVNQQVQQKAVE
TLGTQYSLNTRLGELAMRHPVTCSPSTPLRDAVTLMHEQQVGSIVIVDEHKAPLGIFTLR
DLRQVVADGASDFSQAIDGHMTQAPFFLTPDHSAFDAAIAMTERHIAHVCLVKDQRLCGV
VSERDLFSLQRVDLVHLARTIRNAPRVDNLVAIRGEIGQLVERMLAHGASSTQITHIITL
LNDHTVCRVIELTLAEKGDPGVPFSWLCFGSEGRREQTLYTDQDNGILFDARDAAEAAEI
RGRLLPLAQQINQSLALCGFSLCKGNIMAGNPELCLSRAEWARRFAAFIREATPENLLGS
SIYFDLRVVWGDERGCEQLRQGILDQVADNRLFQRMLAENALRQRPPVGRFREFVLTRKG
GEKATLDLKVQGLTPFVDGARLLALANGIHANNTLERLRQLVVKAVIEPLDGAAYEEAYH
FIQQTRMQQHQLQTRENQPYSNRVDPESLNHLDRRILRESLRQAQRLQSSLTLRYQL