Protein Info for PFLU_RS23210 in Pseudomonas fluorescens SBW25-INTG

Annotation: pilus assembly protein PilZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 PF07317: PilZN" amino acids 17 to 121 (105 residues), 73 bits, see alignment E=1.7e-24 PF07238: PilZ" amino acids 124 to 235 (112 residues), 40.9 bits, see alignment E=2.3e-14

Best Hits

Swiss-Prot: 73% identical to YCGR_PSEPK: Flagellar brake protein YcgR (ycgR) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU4738)

Predicted SEED Role

"FIG00955605: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K0R6 at UniProt or InterPro

Protein Sequence (249 amino acids)

>PFLU_RS23210 pilus assembly protein PilZ (Pseudomonas fluorescens SBW25-INTG)
MFNALNAEDAPQPPKVLTTPLEIASTLRMLQESHDPLIITFHERSQRFQSYLVDVNRDGG
SLALDEMIPRDGERHLENGEPFRIEGFHDGVRIAWESNGSLSISEKDGHRIYTGSLPAEV
VYHQRRNAFRAALKLAQLVNIELGGEKLKAPVNGKLLDISATGCKLRFEGDISERLQLGQ
VYDRFIAALPFGSMTTSVELRYLHFEEKINTTFAGVRFHNMSGLVQRQVERFVYQLQREA
RRFDKDDDF