Protein Info for PFLU_RS22545 in Pseudomonas fluorescens SBW25-INTG

Annotation: bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 754 PF22020: RlmL_1st" amino acids 6 to 61 (56 residues), 57.7 bits, see alignment 2.3e-19 PF02926: THUMP" amino acids 70 to 156 (87 residues), 59.3 bits, see alignment E=1e-19 PF01170: UPF0020" amino acids 165 to 380 (216 residues), 142.4 bits, see alignment E=3.8e-45 PF10672: Methyltrans_SAM" amino acids 513 to 709 (197 residues), 70.6 bits, see alignment E=3.5e-23 PF03602: Cons_hypoth95" amino acids 588 to 676 (89 residues), 29.2 bits, see alignment E=1.8e-10

Best Hits

Swiss-Prot: 91% identical to RLMKL_PSEPF: Ribosomal RNA large subunit methyltransferase K/L (rlmL) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K12297, ribosomal RNA large subunit methyltransferase L [EC: 2.1.1.173] (inferred from 100% identity to pfs:PFLU4601)

Predicted SEED Role

"23S rRNA (guanine-N-2-) -methyltransferase rlmL EC 2.1.1.-)"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.173

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K016 at UniProt or InterPro

Protein Sequence (754 amino acids)

>PFLU_RS22545 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL (Pseudomonas fluorescens SBW25-INTG)
MSDRFELFLTCPKGLEGLLIEEAVGLGLEEAREHTSAVRGMADMETAYRLCLWSRLANRV
LLVLKRFPMKDAEDLYHGVLDIEWADHMVPDGTLAVEFSGHGSGIDNTHFGALKVKDAIV
DKLRTPAGERPSIDKINPDLRIHLRLDRGEAILSLDLSGHSLHQRGYRLQQGAAPLKENL
AAAILIRSGWPRIAAEGGALTDPMCGVGTFLVEGAMIAADMAPNLNRELWGFTTWLGHVP
ALWKKLHTEATERAAIGMNKPPLWVRGYEADPRLIQPARNNIERAGLSHWIKVYQGEVGT
FEPRPDQNQKGLVICNPPYGERLGDEASLLYLYQNLGERLRQACMGWEAAVFTGAPDLGK
RMGIRSHKQYSFWNGALPCKLLLIKVNPDQFVTGERRTPEQRQAEREQAAYDQAPVEPQE
RQYNKNGNPIKPAPAPVVEQARLSEGGQMFANRLQKNLKLLGKWAKREGVDCYRVYDADM
PEYSMAIDLYHDWVHVQEYAAPKSIDPEKASARMFDALAAIPQALNIDKSRVVVKRRERQ
SGTKQYERQSAQGKFTEVSEGGVKLLVNLTDYLDTGLFLDHRPMRMRIQKEAAGKRFLNL
YCYTATASVHAAKGGARSTTSVDLSKTYLDWARRNFSLNGFSDKNRLEQGDVIAWLEASR
DEFDLIFIDPPTFSNSKRMEGIFDVQRDHVQLLDLAMARLAPGGVLYFSNNFRKFVLEDN
LSERYAVEEISDKTLDPDFARNAKIHRAWKITAR