Protein Info for PFLU_RS11695 in Pseudomonas fluorescens SBW25-INTG

Annotation: glutathione-dependent disulfide-bond oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02798: GST_N
  • amino acids 43 to 125 (83 residues), 32.9 bits, E=1.7e-11
• PF13409: GST_N_2
  • amino acids 64 to 125 (62 residues), 27.2 bits, E=1.2e-09
• PF13410: GST_C_2
  • amino acids 172 to 243 (72 residues), 33.9 bits, E=6.7e-12
• PF00043: GST_C
  • amino acids 180 to 248 (69 residues), 27.5 bits, E=7.9e-10

Best Hits

Swiss-Prot: 69% identical to YGHU_ECOLI: Disulfide-bond oxidoreductase YghU (yghU) from Escherichia coli (strain K12)

KEGG orthology group: K11209, GST-like protein (inferred from 100% identity to pfs:PFLU2382)

MetaCyc: 69% identical to disulfide reductase / organic hydroperoxide reductase (Escherichia coli K-12 substr. MG1655)
RXN0-6256

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• pentachlorophenol degradation (3/10 steps found)
• gliotoxin biosynthesis (2/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

See C3K979 at UniProt or InterPro

Protein Sequence (275 amino acids)

>PFLU_RS11695 glutathione-dependent disulfide-bond oxidoreductase (Pseudomonas fluorescens SBW25-INTG)
MTDYVPPTVWTWDTENGGTFASINRPIAGATHDKALPVGKHPLQLYSLATPNGQKVTILL
EELLALGHTGAEYDAWLIKIGDGDQFGSGFVGVNPNSKIPALLDRSGATPIRVFESGAIL
QYLAEKFGAFFPTEPAARAECLSWLFWQMGSAPYLGGGFGHFYAYAPSKMEYAINRFAME
TKRQLDVLDQRLAVSEYIAGDEYTIADIAIWPWYGGLVKGRLYGAAQFLSVHEYTHVLRW
ADAIEARPAVQRGRRVNRVSGEEQLPERHDASDLD