Protein Info for PFLU_RS03940 in Pseudomonas fluorescens SBW25-INTG

Annotation: prepilin peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06750: A24_N_bact
  • amino acids 18 to 124 (107 residues), 113.9 bits, E=3.1e-37
• PF01478: Peptidase_A24
  • amino acids 134 to 243 (110 residues), 92.7 bits, E=1.8e-30

Best Hits

Swiss-Prot: 68% identical to LEP4_PSEST: Type 4 prepilin-like proteins leader peptide-processing enzyme (pilD) from Pseudomonas stutzeri

KEGG orthology group: K02654, leader peptidase (prepilin peptidase) / N-methyltransferase [EC: 2.1.1.- 3.4.23.43] (inferred from 100% identity to pfs:PFLU0790)

MetaCyc: 70% identical to prepilin leader peptidase/N-methyltransferase (Pseudomonas aeruginosa)
Prepilin peptidase. [EC: 3.4.23.43]; 2.1.1.- [EC: 3.4.23.43]

Predicted SEED Role

"Leader peptidase (Prepilin peptidase) (EC 3.4.23.43) / N-methyltransferase (EC 2.1.1.-)" in subsystem Type IV pilus (EC 2.1.1.-, EC 3.4.23.43)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 3.4.23.43

Use Curated BLAST to search for 2.1.1.- or 3.4.23.43

Sequence Analysis Tools

See C3KE94 at UniProt or InterPro

Protein Sequence (288 amino acids)

>PFLU_RS03940 prepilin peptidase (Pseudomonas fluorescens SBW25-INTG)
MNLLLVEQPWAFVAMAGVLGLIVGSFLNVLVWRLPKMLEREWRAQAHEVLGLPAEPAGPT
YNLMHPNSCCPHCNHPIRPWENIPLLSYLFLRGRCAHCQGPISARYPLTELACGLISAWV
AWHFGFGWQAGAMLVLSWGLLAMSLIDADHQLLPDALVMPLLWLGLIVNALGLLTTLPDA
LWGAVIGYMSLWSVFWLFKLATGKDGMGHGDFKLLALLGAWGGWQILPMTLLISSLVGVF
VGLILMRLRKARASTPMPFGPYLAIAGWIALLWGGQITDFYLQSVGFR