Protein Info for PFLU_RS03070 in Pseudomonas fluorescens SBW25-INTG

Annotation: NUDIX hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 PF00293: NUDIX" amino acids 47 to 154 (108 residues), 57 bits, see alignment E=1.1e-19

Best Hits

Swiss-Prot: 69% identical to Y4841_PSEAE: Uncharacterized Nudix hydrolase PA4841 (PA4841) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU0624)

Predicted SEED Role

"Putative Nudix hydrolase YfcD (EC 3.6.-.-)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.6.-.-

Use Curated BLAST to search for 3.6.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K6X2 at UniProt or InterPro

Protein Sequence (178 amino acids)

>PFLU_RS03070 NUDIX hydrolase (Pseudomonas fluorescens SBW25-INTG)
MDATQKEAAHRAASDAELICWVDEQDTLLGSLVRADLRQRGLIGRCTFIFLFNSAGELCV
HRRTLSKAMYPGFWDTAAGGMVAAGESYAVSAARELEEELGVGGVELVEHDHFYFEDGDS
RLWCKSYSAVWDGPLRLQPEEVMEARFLPIGTVLQEAEQKPYCPDAQEGLRRYLASRR