Protein Info for PFLU_RS02660 in Pseudomonas fluorescens SBW25-INTG

Annotation: YgiQ family radical SAM protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 767 TIGR03904: uncharacterized radical SAM protein YgiQ" amino acids 23 to 643 (621 residues), 868.8 bits, see alignment E=8.2e-266 PF08497: Radical_SAM_N" amino acids 23 to 378 (356 residues), 457.2 bits, see alignment E=3.9e-141 PF04055: Radical_SAM" amino acids 379 to 584 (206 residues), 48.8 bits, see alignment E=1.4e-16 PF11842: DUF3362" amino acids 593 to 740 (148 residues), 160.4 bits, see alignment E=5.7e-51

Best Hits

Swiss-Prot: 96% identical to Y4928_PSESM: UPF0313 protein PSPTO_4928 (PSPTO_4928) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU0538)

Predicted SEED Role

"Fe-S OXIDOREDUCTASE (1.8.-.-)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KE72 at UniProt or InterPro

Protein Sequence (767 amino acids)

>PFLU_RS02660 YgiQ family radical SAM protein (Pseudomonas fluorescens SBW25-INTG)
MQTAKPLFDYPKYWAECFGPAPFLPMSREEMDQLGWDSCDIIIVTGDAYVDHPSFGMAII
GRLLESQGFRVGIIAQPNWQSKDDFMKLGEPNLFFGVAAGNMDSMINRYTADKKIRSDDA
YTPGGMAGKRPDRASLVYSQRCKEAYKNVPIVLGGIEASLRRIAHYDYWQDRVRNSILID
ATADILLYGNAERAIVEVAQRLSWGHKIEDITDVRGTAFIRRDTPAGWYEVDSTRIDRPG
KVDKIINPYVNTQDTQACAIEQEKGPVDDPEEAKVVQILASPRMTRDKTVIRLPSVEKVR
GDAVLYAHANRVLHLETNPGNARALVQKHGEVDVWFNPPPIPMTTEEMDYVFGMPYARVP
HPAYGKEKIPAYDMIRFSVNIMRGCFGGCTFCSITEHEGRIIQNRSEESIIREIEEIRDK
VPGFTGVISDLGGPTANMYRIACKSPEIESACRKPSCVFPGICPNLNTDHSSLIQLYRSA
RALPGVKKILIASGLRYDLAVESPEYVKELVTHHVGGYLKIAPEHTEEGPLNQMMKPGIG
SYDKFKRMFEKYTKEAGKEQYLIPYFIAAHPGTTDEDMMNLALWLKGNGFRADQVQAFYP
SPMATATAMYHSGKNPLRKVTYKSDAVTIVKSEEQRRLHKAFLRYHDPKGWPMLREALTR
MGRADLIGPGKDQLIPLHQPSTDSYQSARRKNSTPAGSHKVAKETTTKILTQHTGLPPRG
SDGSNPWDKREQAKAAAQARNKQAAKERTDAAKGKGGKPARKPVVPR