Protein Info for MPMX20_04745 in Enterobacter sp. TBS_079

Annotation: Transposon Tn3 resolvase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 PF00239: Resolvase" amino acids 4 to 137 (134 residues), 133.8 bits, see alignment E=5.3e-43 PF02796: HTH_7" amino acids 140 to 179 (40 residues), 33.9 bits, see alignment 2.7e-12

Best Hits

Swiss-Prot: 61% identical to Y4LS_SINFN: Integrase-like protein y4lS (NGR_a02590) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 94% identity to sbp:Sbal223_0611)

Predicted SEED Role

"RlgA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (186 amino acids)

>MPMX20_04745 Transposon Tn3 resolvase (Enterobacter sp. TBS_079)
MALYGYARVSTSDQDLTLQTQTLRAAGCEIIRAEKASGSSRTGRSELQLLLEFLRPGDTL
MVTRVDRLARSIKDLQDIVFALNQQGVTLRATEQPVDTRSAAGKAFLDMLGVFAEFETNL
RRERQMEGIAAAKARGVYRGRKPSIDPAEVWRLYNTEKMGATAIARQLGIGRASVYRALE
NYEQPA