Protein Info for MPMX20_04691 in Enterobacter sp. TBS_079

Annotation: Coupling protein TraD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 725 transmembrane" amino acids 28 to 47 (20 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 396 to 413 (18 residues), see Phobius details TIGR02759: type IV conjugative transfer system coupling protein TraD" amino acids 9 to 577 (569 residues), 694 bits, see alignment E=9.2e-213 PF12615: TraD_N" amino acids 35 to 125 (91 residues), 55.3 bits, see alignment E=2.1e-18 PF10412: TrwB_AAD_bind" amino acids 173 to 562 (390 residues), 370.1 bits, see alignment E=2.6e-114 PF02534: T4SS-DNA_transf" amino acids 263 to 501 (239 residues), 28.7 bits, see alignment E=1.3e-10 PF12696: TraG-D_C" amino acids 420 to 541 (122 residues), 59.1 bits, see alignment E=9.2e-20

Best Hits

Swiss-Prot: 51% identical to TRAD1_ECOLI: Coupling protein TraD (traD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 91% identity to ecw:EcE24377A_C0001)

Predicted SEED Role

"IncF plasmid conjugative transfer protein TraD" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (725 amino acids)

>MPMX20_04691 Coupling protein TraD (Enterobacter sp. TBS_079)
MSLNPRDLTQGGQVAFMRLKMFLQINNLISYYVIMGTVLFGIAVLLMRMSIQNLTNGIIY
WFVRVMSPFTEKMVSQPVYTIRYYEHNLQYSARQVLSDSYTMYCGQLLKQELVIAGCAAL
LVAFLATFAVYWYLGRTGRKQSEDEIIGGRVLSESPKDVARMMKKRGEASDIRIDDLPLK
LDSEIQNFAMHGTVGSGKSQLMRKILKQLRERGDLVIIYDKGCTFVEDFYDESRDEVLNA
MDARCPNWDLWEECRTISELENASSTLIPASSGEDPFWQGSARTIFAEGAERMRKDEDRS
YNKFLRTLLAIQLDQLRTFLAGTPASTLVDGKIEKTAISIRSVLTNYVKAMRYLQGIDRP
GREKFTIREWMKGQADKSKNGWLFITSDEQYHESLKPLITMWLSIAATSLLAMGENRQRR
VWFVYDEIPSLNKLVTLPRIIAEGRKFGGCFILGFQNEAQMEEIYGPKAAAGLFDLLNTK
FFFRSPSAQIAKFVEEDIGETRRLKFSEQTSFGHEQVRDGISFGKEEERVSIVSYSDVQS
LNDLQCYVTLPGSYPVVKLTMKYEAMPKVADSLLLRDVQTSLDQTIEDELVRRTEEERRN
LDGLFNPVKPAAENPLPETTPQTNIQPKTSPSIAPATATVNTTSSTDATAGSPVTTGGTE
RDIEQDLPQDIPPGLNSDGEVVDFAAYEAWAQSSHQTRDVTRREEVNINHATDKAHDFDD
DREVF