Protein Info for MPMX20_04599 in Enterobacter sp. TBS_079
Annotation: Der GTPase-activating protein YihI
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 86% identical to YIHI_ENT38: Der GTPase-activating protein YihI (yihI) from Enterobacter sp. (strain 638)
KEGG orthology group: K09894, hypothetical protein (inferred from 96% identity to enc:ECL_05116)MetaCyc: 78% identical to Der GTPase-activating protein YihI (Escherichia coli K-12 substr. MG1655)
RXN-21992
Predicted SEED Role
"Protein of unknown function DUF414" in subsystem Experimental tye
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (171 amino acids)
>MPMX20_04599 Der GTPase-activating protein YihI (Enterobacter sp. TBS_079) MKKPTSAAGAKRPAKAHRKTREELNQESRDRKRDKKHRGHAAGSRANGGDASGASAKNKQ QKDPRIGSKTPVPLGVTDTPVTKQHKPKSEKPMLSPQAELDLLENDERLDALLERLEEGE TLTAEEQSWVDAKLDRIDELMQKLGLSYDDDEDEEEDEKQEDMMRLLKGGN