Protein Info for MPMX20_04552 in Enterobacter sp. TBS_079

Annotation: ATP-dependent 6-phosphofructokinase isozyme 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 PF00365: PFK" amino acids 4 to 276 (273 residues), 370.3 bits, see alignment E=3.1e-115 TIGR02482: 6-phosphofructokinase" amino acids 4 to 301 (298 residues), 416.6 bits, see alignment E=2.4e-129

Best Hits

Swiss-Prot: 98% identical to PFKA_ENTCL: ATP-dependent 6-phosphofructokinase (pfkA) from Enterobacter cloacae

KEGG orthology group: K00850, 6-phosphofructokinase [EC: 2.7.1.11] (inferred from 99% identity to enc:ECL_05061)

MetaCyc: 93% identical to 6-phosphofructokinase 1 (Escherichia coli K-12 substr. MG1655)
6-phosphofructokinase. [EC: 2.7.1.11]; 2.7.1.- [EC: 2.7.1.11]

Predicted SEED Role

"6-phosphofructokinase (EC 2.7.1.11)" in subsystem D-Tagatose and Galactitol Utilization or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or N-Acetyl-Galactosamine and Galactosamine Utilization (EC 2.7.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.11

Use Curated BLAST to search for 2.7.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>MPMX20_04552 ATP-dependent 6-phosphofructokinase isozyme 1 (Enterobacter sp. TBS_079)
MIKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVFGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFRDEHVREVAIENMKKRGLDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDIKGTDYTIGYFTALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFVVVPEVEFSREDLVAEIKAGIAKGKKHAIVAITEHICDVDELAKYIETETK
RETRATVLGHIQRGGSPGPYDRILASRMGAYAIELLLQGHGGRCVGIQNEKLVHHDIIDA
IENMKRPFKGDWLDCAKKLY