Protein Info for MPMX20_04552 in Enterobacter sp. TBS_079
Annotation: ATP-dependent 6-phosphofructokinase isozyme 1
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 98% identical to PFKA_ENTCL: ATP-dependent 6-phosphofructokinase (pfkA) from Enterobacter cloacae
KEGG orthology group: K00850, 6-phosphofructokinase [EC: 2.7.1.11] (inferred from 99% identity to enc:ECL_05061)MetaCyc: 93% identical to 6-phosphofructokinase 1 (Escherichia coli K-12 substr. MG1655)
6-phosphofructokinase. [EC: 2.7.1.11]; 2.7.1.- [EC: 2.7.1.11]
Predicted SEED Role
"6-phosphofructokinase (EC 2.7.1.11)" in subsystem D-Tagatose and Galactitol Utilization or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or N-Acetyl-Galactosamine and Galactosamine Utilization (EC 2.7.1.11)
MetaCyc Pathways
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (25/26 steps found)
- superpathway of glycolysis and the Entner-Doudoroff pathway (17/17 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (18/19 steps found)
- glycolysis I (from glucose 6-phosphate) (13/13 steps found)
- superpathway of anaerobic sucrose degradation (17/19 steps found)
- superpathway of N-acetylneuraminate degradation (19/22 steps found)
- glycolysis II (from fructose 6-phosphate) (11/11 steps found)
- glycolysis III (from glucose) (11/11 steps found)
- superpathway of hexitol degradation (bacteria) (16/18 steps found)
- homolactic fermentation (11/12 steps found)
- superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
- D-galactosamine and N-acetyl-D-galactosamine degradation (4/4 steps found)
- glycolysis IV (8/10 steps found)
- sedoheptulose bisphosphate bypass (2/2 steps found)
- 1,3-propanediol biosynthesis (engineered) (7/9 steps found)
- formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
- N-acetyl-D-galactosamine degradation (4/5 steps found)
- galactitol degradation (3/5 steps found)
- lactose degradation I (2/5 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Fructose and mannose metabolism
- Galactose metabolism
- Glycolysis / Gluconeogenesis
- Pentose phosphate pathway
Isozymes
Compare fitness of predicted isozymes for: 2.7.1.11
Use Curated BLAST to search for 2.7.1.11
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (320 amino acids)
>MPMX20_04552 ATP-dependent 6-phosphofructokinase isozyme 1 (Enterobacter sp. TBS_079) MIKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVFGIYDGYLGLYEDRMVQLDRYSVSD MINRGGTFLGSARFPEFRDEHVREVAIENMKKRGLDALVVIGGDGSYMGAKRLTEMGFPC IGLPGTIDNDIKGTDYTIGYFTALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA AAIAGGCEFVVVPEVEFSREDLVAEIKAGIAKGKKHAIVAITEHICDVDELAKYIETETK RETRATVLGHIQRGGSPGPYDRILASRMGAYAIELLLQGHGGRCVGIQNEKLVHHDIIDA IENMKRPFKGDWLDCAKKLY