Protein Info for MPMX20_04514 in Enterobacter sp. TBS_079

Annotation: Vitamin B12 transporter BtuB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 616 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR01779: TonB-dependent vitamin B12 receptor" amino acids 2 to 616 (615 residues), 732.4 bits, see alignment E=2.3e-224 PF07715: Plug" amino acids 39 to 145 (107 residues), 100.3 bits, see alignment E=9e-33 PF00593: TonB_dep_Rec_b-barrel" amino acids 218 to 590 (373 residues), 170.8 bits, see alignment E=1e-53

Best Hits

Swiss-Prot: 67% identical to BTUB_ENT38: Vitamin B12 transporter BtuB (btuB) from Enterobacter sp. (strain 638)

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 91% identity to enc:ECL_05021)

MetaCyc: 64% identical to cobalamin outer membrane transporter (Escherichia coli K-12 substr. MG1655)
RXN0-1565; TRANS-RXN0-283

Predicted SEED Role

"Outer membrane vitamin B12 receptor BtuB" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (616 amino acids)

>MPMX20_04514 Vitamin B12 transporter BtuB (Enterobacter sp. TBS_079)
MIKKVSLLTALSVTAFSGWAQDSDDSLVVTANRFEQPVNTVLAPTSVVTREDIDRWQAKS
VVEVMSRLPGVDIAQSGGLGATSSTFIRGTESRHVLVLIDGIPLNNAGISNVPDLSQIPT
SLIQRIEYIRGPRSALYGSDAIGGVINIITGRDKPGAEISAGVGSKGYQTYDGSFQQVLE
KTKITMAGNYTYTRGFDIGAKDAPRQPDRDGFMSKSLYGSVEQQITDSVSGFFRGFGYDN
RTAYDGYDHYDANFNVDGRPDTRQLYSQNWDTGLRYSQGIFKSQLAIGYGRSKDQNYDPK
KGRYSDSATTDDVKQYTTQWLNSLEVGHGNIGAGLDWQKQKTQAGSSTMDNGYEQRNTGV
FLSAMQQFDSLTLEAAARNDDNSNFGSHATWQTSAAWEFIDGYRIIGSYGTAYKAPTMSQ
IHSEKYGNPDLKPEESKQWEGGFEGLTGPVNWRVTAYRNDIDNLIGYDANYRYYNVDEAR
IKGIEATAQFETGPVGHQISYDYVDPRNTKTNEVLARRSKQQVKYQLDWQVWDLDWNVSY
RFLGTRYDVAVDPNTYSTERVKMGGVSLWDVAVSYPVTSHLTVRGKIANLFDKDYETVYG
YQTAGREYTLSGSYTF