Protein Info for MPMX20_04501 in Enterobacter sp. TBS_079

Annotation: Acetolactate synthase isozyme 2 small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 87 PF13710: ACT_5" amino acids 13 to 73 (61 residues), 89.8 bits, see alignment E=4e-30

Best Hits

Swiss-Prot: 90% identical to ILVM_ECOLI: Acetolactate synthase isozyme 2 small subunit (ilvM) from Escherichia coli (strain K12)

KEGG orthology group: K11258, acetolactate synthase II small subunit [EC: 2.2.1.6] (inferred from 91% identity to sek:SSPA3486)

Predicted SEED Role

"Acetolactate synthase small subunit (EC 2.2.1.6)" in subsystem Acetoin, butanediol metabolism or Branched-Chain Amino Acid Biosynthesis (EC 2.2.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (87 amino acids)

>MPMX20_04501 Acetolactate synthase isozyme 2 small subunit (Enterobacter sp. TBS_079)
MMQHQVAVQARFNPETLERVLRVVRHRGFQICSMNMETATDAQNISIELTVASPRSVDLL
FSQLTKLVDVAHVAICQSTTTSQQIRA