Protein Info for MPMX20_04460 in Enterobacter sp. TBS_079

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00369: uncharacterized domain 1
  • amino acids 25 to 153 (129 residues), 50.4 bits, E=1.1e-17
• PF13622: 4HBT_3
  • amino acids 52 to 153 (102 residues), 32.5 bits, E=8.2e-12
• PF03061: 4HBT
  • amino acids 58 to 143 (86 residues), 48.9 bits, E=6.9e-17

Best Hits

Swiss-Prot: 95% identical to YIGI_SALTI: Uncharacterized protein YigI (yigI) from Salmonella typhi

KEGG orthology group: None (inferred from 93% identity to eok:G2583_4620)

MetaCyc: 93% identical to acyl-CoA thioesterase YigI (Escherichia coli K-12 substr. MG1655)
Acyl-CoA hydrolase. [EC: 3.1.2.20]; Palmitoyl-CoA hydrolase. [EC: 3.1.2.20, 3.1.2.2]; 3.1.2.2 [EC: 3.1.2.20, 3.1.2.2]

Predicted SEED Role

"putative protein PaaI, possibly involved in aromatic compounds catabolism"

MetaCyc Pathways

• acyl-CoA hydrolysis (1/1 steps found)
• bacterial bioluminescence (4/8 steps found)
• stearate biosynthesis I (animals) (1/6 steps found)
• sporopollenin precursors biosynthesis (5/18 steps found)
• firefly bioluminescence (2/14 steps found)
• cutin biosynthesis (2/16 steps found)
• jasmonic acid biosynthesis (4/19 steps found)
• suberin monomers biosynthesis (3/20 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.2 or 3.1.2.20

Protein Sequence (155 amino acids)

>MPMX20_04460 hypothetical protein (Enterobacter sp. TBS_079)
MSAMLTAEEALKLVGEIFVYHMPFNRALGLELERYEKAFAQLSFNNQPMMVGNWAQSILH
GGVIASALDVAAGLVCVGSTLTRHDTINEDELRQRLSRMGTIDLRVDYLRPGRGNRFTAT
SSLLRAGNKVAVARVELHNEEQVYIASATATYMVG