Protein Info for MPMX20_04419 in Enterobacter sp. TBS_079

Annotation: Cellulose biosynthesis protein BcsQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 TIGR03371: cellulose synthase operon protein YhjQ" amino acids 1 to 239 (239 residues), 262.8 bits, see alignment E=1.5e-82 PF06564: CBP_BcsQ" amino acids 1 to 236 (236 residues), 353.7 bits, see alignment E=4.7e-110 PF13614: AAA_31" amino acids 5 to 149 (145 residues), 34.8 bits, see alignment E=1.6e-12

Best Hits

Swiss-Prot: 76% identical to BCSQ_SALTY: Cellulose biosynthesis protein BcsQ (bcsQ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 94% identity to enc:ECL_04939)

Predicted SEED Role

"Cellulose synthase, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (250 amino acids)

>MPMX20_04419 Cellulose biosynthesis protein BcsQ (Enterobacter sp. TBS_079)
MAILGLQGVRGGVGTTSVTAALAWSLQLLGESVLVIDACADNLLRMSFNVDFTRTEGWAR
ALLDDKDWRDAGMRYTSQLDVLPFGQLTTTERENEAAYQRLFSQFTVALQELKEKGHYKW
ILLDLPHGAGTLTRQLMAQCDRVLSIVNVDANCHIRLHQQGLPENGHILINDLRIGSQIQ
DDLYQVWLQSQRRLLPIVIHRDEGMAECLASKQPLGEYRSDSLAAEEILTLANWCLLHFA
KGAEPAGSSV