Protein Info for MPMX20_04405 in Enterobacter sp. TBS_079

Annotation: 3-oxoacyl-[acyl-carrier-protein] reductase FabG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF00106: adh_short" amino acids 5 to 196 (192 residues), 137.2 bits, see alignment E=7.3e-44 PF08659: KR" amino acids 7 to 184 (178 residues), 45.8 bits, see alignment E=1e-15 PF13561: adh_short_C2" amino acids 13 to 250 (238 residues), 163.1 bits, see alignment E=1.3e-51

Best Hits

Swiss-Prot: 30% identical to TRN2_HYONI: Tropinone reductase 2 (TR2) from Hyoscyamus niger

KEGG orthology group: None (inferred from 90% identity to enc:ECL_04923)

Predicted SEED Role

"FIG00626899: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>MPMX20_04405 3-oxoacyl-[acyl-carrier-protein] reductase FabG (Enterobacter sp. TBS_079)
MSERIALVTGGSRGLGKNAALKLAADGTGIILTYNRSQQDALDVVREIQQKGVNAAALQL
NVGDIASFDLFAAQLQEILKTVWQRETFDYLLNNAGTGLYAPYAETTEAQFDEALNIHFK
GPFFLTQRLLPLLNDGGRILNVSSGLARFTQPGSGTYAAMKGAMEVLTRYQAKELGARGI
SVNIIAPGTIETDFGGGRVRDNAQLNQMLASQTALGRVGLPDDIGDAIAALLSDKLGWMN
AQRIEVSGGMFL