Protein Info for MPMX20_04392 in Enterobacter sp. TBS_079

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 37 to 50 (14 residues), see Phobius details PF00890: FAD_binding_2" amino acids 33 to 76 (44 residues), 30.8 bits, see alignment 9e-11 PF12831: FAD_oxidored" amino acids 33 to 168 (136 residues), 30.1 bits, see alignment E=1.6e-10 PF03486: HI0933_like" amino acids 33 to 420 (388 residues), 319.7 bits, see alignment E=6.4e-99 PF07992: Pyr_redox_2" amino acids 33 to 190 (158 residues), 37.2 bits, see alignment E=1.2e-12 TIGR00275: flavoprotein, HI0933 family" amino acids 35 to 420 (386 residues), 420.7 bits, see alignment E=2.7e-130 PF13450: NAD_binding_8" amino acids 36 to 67 (32 residues), 23.4 bits, see alignment (E = 2.9e-08) PF01593: Amino_oxidase" amino acids 127 to 275 (149 residues), 22.5 bits, see alignment E=3.2e-08 PF22780: HI0933_like_1st" amino acids 216 to 367 (152 residues), 165.9 bits, see alignment E=3.7e-52

Best Hits

Swiss-Prot: 86% identical to YHIN_ECOLI: Uncharacterized protein YhiN (yhiN) from Escherichia coli (strain K12)

KEGG orthology group: K07007, (no description) (inferred from 97% identity to enc:ECL_04910)

Predicted SEED Role

"NAD(FAD)-utilizing dehydrogenases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>MPMX20_04392 hypothetical protein (Enterobacter sp. TBS_079)
MTDISVNCAGVTTEETLQSAAVNEEDFDVERFDAVVIGAGAAGMFCAAMAGQAGRRVLLL
DNGKKPGRKILMSGGGRCNFTNLYVEPAAYLSQNRHFCKSALARYTQWDFIDLVGKHGIA
WHEKTLGQLFCDDSAQQIVDMLVAECEKGGVVMRLRTEVLEVSRDEQGYTLQLNGESVSA
DNLVIASGGLSMPGLGASPFGYKIAEQFGLNVLPTRAGLVPFTLHKPLLEQLQTLSGVSV
PSVITAEDGTVFRENLLFTHRGLSGPAVLQISSYWQPGEFVTVNLIPDCDLEAFLNEQRA
AHPNQSLKNTLAMQLPKRLVECLQVLGQIPDVSLKQLNSREQAVLVETLTAWRVQPNGTE
GYRTAEVTLGGVDTNELSSRTMEARNVPGLYFIGEVMDVTGWLGGYNFQWAWASAWACAQ
ALAEDK