Protein Info for MPMX20_04376 in Enterobacter sp. TBS_079

Annotation: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 551 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 81 to 105 (25 residues), see Phobius details amino acids 111 to 152 (42 residues), see Phobius details amino acids 165 to 195 (31 residues), see Phobius details amino acids 204 to 227 (24 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details amino acids 291 to 309 (19 residues), see Phobius details amino acids 315 to 336 (22 residues), see Phobius details amino acids 348 to 368 (21 residues), see Phobius details amino acids 380 to 401 (22 residues), see Phobius details amino acids 408 to 430 (23 residues), see Phobius details PF02366: PMT" amino acids 5 to 237 (233 residues), 171.8 bits, see alignment E=1.9e-54 PF13231: PMT_2" amino acids 61 to 222 (162 residues), 39.4 bits, see alignment E=7.3e-14

Best Hits

Swiss-Prot: 70% identical to ARNT_KLEP7: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase (arnT) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K07264, 4-amino-4-deoxy-L-arabinose transferase [EC: 2.-.-.-] (inferred from 88% identity to enc:ECL_04859)

MetaCyc: 63% identical to lipid IVA 4-amino-4-deoxy-L-arabinosyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-2001 [EC: 2.4.2.43]

Predicted SEED Role

"Polymyxin resistance protein ArnT, undecaprenyl phosphate-alpha-L-Ara4N transferase; Melittin resistance protein PqaB"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.4.2.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (551 amino acids)

>MPMX20_04376 Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase (Enterobacter sp. TBS_079)
MKAARYGLALLALFIVYYLIPIDIRLLWQPDETRYAEISREMLASGDWIVPHFLGLRYFE
KPIAGYWINSIGQLLFGHTNFAVRAGAIFSTGLTALLVIWMAWRLWRDKRVAIFSGLIFL
TLFLVYGIGTYAVLDPIITLWLVAAMCSFWLASQAETVAGKAGGYVLLGLACGMGVMTKG
FLALAVPVIGVLPWVIAQKRWKEVLIFGWMAIVSCVLIVLPWALAIAHREPDFWRYFFWV
EHIQRFAQSDAQHKAPFWYYLPFLLAGSLPWLALLPGAFRLGWRERDNTGGGFYLLGWVV
MPLLFFSIAKGKLPTYILPCFAPLAILMARYACIAADKGARALRINGGINLAFGVIGVVA
ALVVSPWGVAKHPVWTSVELYKVFCAVLAFLVWAAVGWFTVRQSAQRWWLAALCPAGVAL
LIGFAIPNLVVDSKQPQSLVDTIRDPLQSSRFVLANNVGVASGLAWELKRNDIILFGQSG
ELSYGLAYPDVKDRFVEKDNFAQWLATHRQQGGVSLVILLSKHDDIKRAHLPEPDSLYIQ
GRLAWLQYLPQ