Protein Info for MPMX20_04353 in Enterobacter sp. TBS_079

Annotation: putative MFS-type transporter YhhS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 19 to 40 (22 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 137 to 140 (4 residues), see Phobius details amino acids 152 to 177 (26 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 220 to 244 (25 residues), see Phobius details amino acids 252 to 271 (20 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details amino acids 311 to 330 (20 residues), see Phobius details amino acids 342 to 365 (24 residues), see Phobius details amino acids 370 to 388 (19 residues), see Phobius details PF07690: MFS_1" amino acids 24 to 349 (326 residues), 102.4 bits, see alignment E=1.2e-33 amino acids 276 to 394 (119 residues), 36.7 bits, see alignment E=1.2e-13

Best Hits

Swiss-Prot: 85% identical to YHHS_ECOL6: Uncharacterized MFS-type transporter YhhS (yhhS) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 96% identity to enc:ECL_04838)

Predicted SEED Role

"Transporter, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (405 amino acids)

>MPMX20_04353 putative MFS-type transporter YhhS (Enterobacter sp. TBS_079)
MPEHAAEPALSGLRLNLRIVSVVIFNFASYLTIGLPLAVLPGYVHDVMGFSAFWAGLVIS
LQYFATLLSRPHAGRYADLFGPKRIVIVGLCGCFLSGLGYLLAATTSHWPLVSLALLCLG
RVILGIGQSLAGTGSTLWGVGVVGASHIGRVISWNGIVTYGAMALGAPLGVICYAYGGLS
GLAITIMVVALLAILFALPRPKVKASKGKPLPFRAVLGRVWPYGMALALATTGFGVIATF
ITLFYDAKGWDGAAFALTLFSCAFVGARLLFPNGINRLGGLNVALICFAVEIVGLVLTGI
ATAPWMAKMGVFLAGAGFSLVFPALGVVAVKAVPQQNQGSALATYTVFMDMSLGITGPLA
GLVMAWAGVPVIYLAAAGLVVIALMLTWRLKKWPPVQAPEATSSS