Protein Info for MPMX20_04342 in Enterobacter sp. TBS_079

Annotation: Ribosomal RNA small subunit methyltransferase D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 TIGR00095: 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD" amino acids 1 to 189 (189 residues), 243.5 bits, see alignment E=7.1e-77 PF03602: Cons_hypoth95" amino acids 12 to 187 (176 residues), 212.4 bits, see alignment E=4.4e-67 PF05175: MTS" amino acids 43 to 135 (93 residues), 23.8 bits, see alignment E=3e-09

Best Hits

Swiss-Prot: 83% identical to RSMD_ECOL6: Ribosomal RNA small subunit methyltransferase D (rsmD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K08316, ribosomal RNA small subunit methyltransferase D [EC: 2.1.1.171] (inferred from 89% identity to ent:Ent638_3869)

MetaCyc: 83% identical to 16S rRNA m2G966 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-6515 [EC: 2.1.1.171]

Predicted SEED Role

"16S rRNA (guanine(966)-N(2))-methyltransferase (EC 2.1.1.171)" (EC 2.1.1.171)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.171

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (200 amino acids)

>MPMX20_04342 Ribosomal RNA small subunit methyltransferase D (Enterobacter sp. TBS_079)
MKKPNRAPAGQIRIIGGQWRGRKLPVPDSPGLRPTTDRVRETLFNWLAPSMVDAHCLDCF
AGSGALGLEALSRYAASATLLEMERGVAQTLQQNLATLKATNAKVVNTNTLSFLAQKGTP
HNVVFVDPPFRKGLLEETLSLLENNGWLADDALIYVESEVENGLPPVPVHWDLHREKVAG
QVAYRLYHRQAQGESNASTD