Protein Info for MPMX20_04234 in Enterobacter sp. TBS_079

Annotation: 30S ribosomal protein S7

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 PF00177: Ribosomal_S7" amino acids 1 to 149 (149 residues), 216.8 bits, see alignment E=5.6e-69 TIGR01029: ribosomal protein uS7" amino acids 3 to 156 (154 residues), 236.2 bits, see alignment E=7.3e-75

Best Hits

Swiss-Prot: 99% identical to RS7_KLEP3: 30S ribosomal protein S7 (rpsG) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K02992, small subunit ribosomal protein S7 (inferred from 98% identity to ect:ECIAI39_3821)

MetaCyc: 98% identical to 30S ribosomal subunit protein S7 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S7p (S5e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (156 amino acids)

>MPMX20_04234 30S ribosomal protein S7 (Enterobacter sp. TBS_079)
MPRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAEAIVYSALETLAQRSGKNELE
AFEVALDNVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWIVEAARKRGDKSMALRL
ANELSDAAENKGTAVKKREDVHRMAEANKAFAHYRW