Protein Info for MPMX20_04153 in Enterobacter sp. TBS_079

Annotation: Ribonuclease G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 TIGR00757: ribonuclease, Rne/Rng family" amino acids 13 to 426 (414 residues), 586.3 bits, see alignment E=1.7e-180 PF00575: S1" amino acids 38 to 109 (72 residues), 27.3 bits, see alignment E=5.7e-10 PF10150: RNase_E_G" amino acids 124 to 393 (270 residues), 353 bits, see alignment E=1.6e-109 PF20833: RNase_E_G_Thio" amino acids 405 to 486 (82 residues), 32.8 bits, see alignment E=9.3e-12

Best Hits

Swiss-Prot: 96% identical to RNG_ECOLI: Ribonuclease G (rng) from Escherichia coli (strain K12)

KEGG orthology group: K08301, ribonuclease G [EC: 3.1.26.-] (inferred from 98% identity to ent:Ent638_3683)

MetaCyc: 96% identical to RNase G (Escherichia coli K-12 substr. MG1655)
Ribonuclease E. [EC: 3.1.26.12]

Predicted SEED Role

"Cytoplasmic axial filament protein CafA and Ribonuclease G (EC 3.1.4.-)" in subsystem Bacterial Cell Division or RNA processing and degradation, bacterial (EC 3.1.4.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.12, 3.1.4.-

Use Curated BLAST to search for 3.1.26.- or 3.1.26.12 or 3.1.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (489 amino acids)

>MPMX20_04153 Ribonuclease G (Enterobacter sp. TBS_079)
MTAELLVNVTPSETRVAYIDGGILQEIHIEREARRGIVGNIYKGRVSRVLPGMQAAFVDI
GLDKAAFLHASDIMPHTECVAGEEQKQFAVRDISELVRQGQDLMVQVVKDPLGTKGARLT
TDITLPSRYLVFMPGASHVGVSQRIESESERERLKKVVSAYCDEQGGFIIRTAAEGISED
DLASDAAYLKRVWTKVMERKKRNQTRYQLYGELALAQRVLRDFADAQLDRIRVDSRLTYE
ALLEFTAEYIPEMPGLLEHYTGRQPIFDLYDVENEIQRALERKVELKSGGYLIIDQTEAM
TTVDINTGAFVGHRNLDDTIFNTNIEATQAIARQLRLRNLGGIIIIDFIDMSNEDHRRRV
LHSLEQALSKDRVKTSINGFSQLGLVEMTRKRTRESVEHVLCNECPTCHGRGTVKTVETV
CYEIMREIVRVHHAYDSDRFLVYASPAVAEALKGEESHALAEVEIFVGKQVKVQIEPLYN
QEQFDVVMM