Protein Info for MPMX20_04110 in Enterobacter sp. TBS_079

Annotation: Nitrogen regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 TIGR01419: PTS IIA-like nitrogen-regulatory protein PtsN" amino acids 9 to 155 (147 residues), 208.7 bits, see alignment E=1.6e-66 PF00359: PTS_EIIA_2" amino acids 13 to 155 (143 residues), 126.1 bits, see alignment E=5.5e-41

Best Hits

Swiss-Prot: 93% identical to PTSN_SHIFL: Nitrogen regulatory protein (ptsN) from Shigella flexneri

KEGG orthology group: K02806, PTS system, nitrogen regulatory IIA component [EC: 2.7.1.69] (inferred from 98% identity to ent:Ent638_3640)

Predicted SEED Role

"PTS system nitrogen-specific IIA component, PtsN"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (163 amino acids)

>MPMX20_04110 Nitrogen regulatory protein (Enterobacter sp. TBS_079)
MMNNDSALQLSNVLNQECTRSAVHCQSKKRALEIISELAAKQLGLPPQVVFEAILTREKM
GSTGIGNGIAIPHGKLEEDTLRAVGVFVQLETPIAFDAIDNQPVDLLFALLVPADQTKTH
LHTLSLVAKRLADKTICRRLRAAQSDEELYQIITEAEGNQDDA