Protein Info for MPMX20_04052 in Enterobacter sp. TBS_079

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 TIGR00252: TIGR00252 family protein" amino acids 16 to 128 (113 residues), 176.8 bits, see alignment E=7.5e-57 PF02021: UPF0102" amino acids 24 to 114 (91 residues), 90.4 bits, see alignment E=4.1e-30

Best Hits

Swiss-Prot: 92% identical to Y3585_ENT38: UPF0102 protein Ent638_3585 (Ent638_3585) from Enterobacter sp. (strain 638)

KEGG orthology group: K07460, putative endonuclease (inferred from 92% identity to ent:Ent638_3585)

Predicted SEED Role

"Predicted endonuclease distantly related to archaeal Holliday junction resolvase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (131 amino acids)

>MPMX20_04052 hypothetical protein (Enterobacter sp. TBS_079)
MAQIPAGANRPGQLSRKETGDAWELKARRWLEGKGLHFIAANVRGRGGEIDLIMKDGEVI
VFVEVRYRQSSRFGGAAASVTFAKQHKLLQTAHLWLARHNGSFDTVDCRFDVVAFTGNAI
EWLKNAFGEDA