Protein Info for MPMX20_04050 in Enterobacter sp. TBS_079

Annotation: Ribosomal RNA small subunit methyltransferase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 PF00590: TP_methylase" amino acids 14 to 213 (200 residues), 119.8 bits, see alignment E=1.7e-38 TIGR00096: 16S rRNA (cytidine(1402)-2'-O)-methyltransferase" amino acids 14 to 283 (270 residues), 376.9 bits, see alignment E=2.9e-117 PF23016: RsmI_C" amino acids 240 to 285 (46 residues), 64.2 bits, see alignment 8e-22

Best Hits

Swiss-Prot: 94% identical to RSMI_ECO57: Ribosomal RNA small subunit methyltransferase I (rsmI) from Escherichia coli O157:H7

KEGG orthology group: K07056, (no description) (inferred from 98% identity to enc:ECL_04528)

MetaCyc: 94% identical to 16S rRNA 2'-O-ribose C1402 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11637 [EC: 2.1.1.198]

Predicted SEED Role

"rRNA small subunit methyltransferase I" in subsystem Heat shock dnaK gene cluster extended

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.198

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>MPMX20_04050 Ribosomal RNA small subunit methyltransferase I (Enterobacter sp. TBS_079)
MKQHETADNSQGQLYIVPTPIGNLSDITQRALTVLQAVDLIAAEDTRHTGLLLQHFAISA
RLFALHDHNEQQKAETLVAKLKEGQNIALVSDAGTPLINDPGYHLVRTCREAGIRVVPLP
GPCAAIAALSAAGLPSDRFCYEGFLPAKSKGRRDVLKALEAEPRTLIFYESTHRLLESLE
DMVTVWGEARYVVLARELTKTWETIHGAPVGELLAWVKEDENRRKGEMVLIVEGHKAQED
ALPADALRTLALLQAELPLKKAAALAAEIHGVKKNALYKYALEQQG