Protein Info for MPMX20_04012 in Enterobacter sp. TBS_079

Annotation: Inner membrane protein YhaH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 transmembrane" amino acids 23 to 43 (21 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details PF05656: DUF805" amino acids 11 to 117 (107 residues), 128.7 bits, see alignment E=5.9e-42

Best Hits

Swiss-Prot: 80% identical to YHAH_ECOLI: Inner membrane protein YhaH (yhaH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 87% identity to ent:Ent638_3557)

Predicted SEED Role

"Inner membrane protein YhaH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (121 amino acids)

>MPMX20_04012 Inner membrane protein YhaH (Enterobacter sp. TBS_079)
MDWYLKVLRNYIGFGGRARRKEYWMFVLVNFILIMVLGIIDKILGWERAGGEGVLTTIYG
LLVLLPSWAVLFRRLHDTDRSAWWLLLLLIPIVGWLVILVFNCQAGTPGENRFGPDPKLN
A