Protein Info for MPMX20_03822 in Enterobacter sp. TBS_079

Annotation: 2-(5''-triphosphoribosyl)-3'-dephosphocoenzyme-A synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 TIGR03125: triphosphoribosyl-dephospho-CoA synthase CitG" amino acids 16 to 265 (250 residues), 293.3 bits, see alignment E=9.8e-92 PF01874: CitG" amino acids 17 to 263 (247 residues), 237 bits, see alignment E=1.6e-74

Best Hits

Swiss-Prot: 49% identical to CITG_CITK8: Probable 2-(5''-triphosphoribosyl)-3'-dephosphocoenzyme-A synthase (citG) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K05966, triphosphoribosyl-dephospho-CoA synthase [EC: 2.7.8.25] (inferred from 84% identity to enc:ECL_04293)

Predicted SEED Role

"2-(5''-triphosphoribosyl)-3'-dephosphocoenzyme-A synthase (EC 2.7.8.25)" (EC 2.7.8.25)

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.25

Use Curated BLAST to search for 2.7.8.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>MPMX20_03822 2-(5''-triphosphoribosyl)-3'-dephosphocoenzyme-A synthase (Enterobacter sp. TBS_079)
MTGLLATNPQPCDVPGLAEEALWQELALTPKPGLVDKLNNGAHRDMDHALFTRSIAAITP
WFARFAELGHTHADKPAAEQIRIIRPMGIACEQAMYAATCGVNTHKGGIFALGLLCFAAG
RVKHATAESLCSEVSHLCRGLVARELAARSGQATAGERQFQQYGLTGARGEAESGFATVR
AALAQWNGHALHDLLLRLMAMNQDSNLVSRGGMEGLRYVQGYARALLTRGWDRDALIQMD
NALIERNLSPGGSADLLSVGWVLAKLPLS