Protein Info for MPMX20_03809 in Enterobacter sp. TBS_079

Annotation: Pyridoxal phosphate homeostasis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 TIGR00044: pyridoxal phosphate enzyme, YggS family" amino acids 1 to 229 (229 residues), 332.1 bits, see alignment E=9.1e-104 PF01168: Ala_racemase_N" amino acids 7 to 229 (223 residues), 78.6 bits, see alignment E=3e-26

Best Hits

Swiss-Prot: 86% identical to PLPHP_ECO57: Pyridoxal phosphate homeostasis protein (yggS) from Escherichia coli O157:H7

KEGG orthology group: K06997, (no description) (inferred from 92% identity to enc:ECL_04280)

Predicted SEED Role

"Hypothetical protein YggS, proline synthase co-transcribed bacterial homolog PROSC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (233 amino acids)

>MPMX20_03809 Pyridoxal phosphate homeostasis protein (Enterobacter sp. TBS_079)
MNDIAHNLAQVRDKISAAATRCGRASEEITLLAVSKTKPASAIADAIEAGQHAFGENYVQ
EGVDKIRFFQEQGKTDLQWHFIGPLQSNKSRLVAEHFDWCHTIDRLRIASRLNDQRPEAL
PPLNVLIQVNISDENSKSGIALEELDALAADVAALPRLTLRGLMAIPAPESSYERQFAVA
QQMAVAFEALKARYQTVDTLSLGMSDDMEAAIAAGSTMVRIGTAIFGARDYTQ