Protein Info for MPMX20_03673 in Enterobacter sp. TBS_079

Annotation: Cysteine desulfurase CsdA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 TIGR03392: cysteine desulfurase, catalytic subunit CsdA" amino acids 4 to 401 (398 residues), 737.6 bits, see alignment E=2e-226 PF00266: Aminotran_5" amino acids 21 to 388 (368 residues), 470.8 bits, see alignment E=1.5e-145

Best Hits

Swiss-Prot: 84% identical to CSDA_ECOLI: Cysteine desulfurase CsdA (csdA) from Escherichia coli (strain K12)

KEGG orthology group: K01766, cysteine sulfinate desulfinase [EC: 4.4.1.-] (inferred from 94% identity to enc:ECL_04136)

MetaCyc: 84% identical to cysteine sulfinate desulfinase (Escherichia coli K-12 substr. MG1655)
2.8.7.M1 [EC: 2.8.7.M1]

Predicted SEED Role

"Cysteine desulfurase CsdA-CsdE (EC 2.8.1.7), main protein CsdA" in subsystem Alanine biosynthesis (EC 2.8.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.7

Use Curated BLAST to search for 2.8.1.7 or 2.8.7.M1 or 4.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>MPMX20_03673 Cysteine desulfurase CsdA (Enterobacter sp. TBS_079)
MNAFSPAQFRAQFPALADAGIYLDSAATALKPQAVIEATQQFYSLSAGNVHRSQFAEAQR
LTARYEAARDQVARLINAESGKNIVWTRGTTEAINMVAQCYARPRLKPGDEIIVSEAEHH
ANLVPWLMVAEQTGARIVKLPLGADLLPDVARLSEFITPRSRILALGQMSNVTGGCPDLA
LAIDVAHANDMVVMVDGAQGVVHFPADVQKLDIDFYAFSGHKLYGPTGIGVLYGKPTLLA
QMTPWLGGGKMITEVTFEGFKTQDVPYRLEAGTPNVAGVIGLSAALEWLAETDIAQAERW
SRGLATLAEEALQKRPGFRSFRVQDSSLLAFDFAGVHHSDMVTLLAGYGIALRAGQHCAQ
PLLAALGVSGTLRASFAPYNTQSDVDALVDAVDRALEILVD