Protein Info for MPMX20_03668 in Enterobacter sp. TBS_079

Annotation: Flap endonuclease Xni

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF02739: 5_3_exonuc_N" amino acids 5 to 144 (140 residues), 107 bits, see alignment E=8.4e-35 PF01367: 5_3_exonuc" amino acids 160 to 250 (91 residues), 99.6 bits, see alignment E=1.2e-32

Best Hits

Swiss-Prot: 85% identical to XNI_ESCF3: Flap endonuclease Xni (xni) from Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)

KEGG orthology group: K01146, protein Xni (inferred from 96% identity to enc:ECL_04131)

Predicted SEED Role

"DNA polymerase I (EC 2.7.7.7)" in subsystem DNA-replication or DNA Repair Base Excision (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>MPMX20_03668 Flap endonuclease Xni (Enterobacter sp. TBS_079)
MAVHLLIVDALNLIRRIHAVQGTPCKDTCLHALEQLIRHSEPTHVVAVFDDEARNSGWRH
QRLPDYKAGRAPMPDDLHAEMPAIRAAFEQRGVPCWGAHGNEADDLAATLAVKVANAGHQ
ATIVSTDKGYCQLLSPTVRIRDYFQKRWLDAPFIASEFGVSPEQLPDYWGLAGISSSKVP
GVAGIGPKSAAQLLTDFQSLEGIYARLDEVPEKWRKKLETHKEMAFICRDVATLQTDLQL
DGNLQQLRLER