Protein Info for MPMX20_03635 in Enterobacter sp. TBS_079

Annotation: Inner membrane protein YgbE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 54 to 78 (25 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details PF12084: DUF3561" amino acids 1 to 108 (108 residues), 167.2 bits, see alignment E=5.2e-54

Best Hits

Swiss-Prot: 71% identical to YGBE_ECOLI: Inner membrane protein YgbE (ygbE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to enc:ECL_04098)

Predicted SEED Role

"Putative cytochrome oxidase subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (108 amino acids)

>MPMX20_03635 Inner membrane protein YgbE (Enterobacter sp. TBS_079)
MRNSENYIITTGSEPLATDDETTWSFPGAIVGFVSWLLALGIPFLIYGGNTLFFFLYTWP
FFLALMPVAVVVGIALHSLLNGKLLYSTVVTIVTVVLMFGLLFLWLMG