Protein Info for MPMX20_03608 in Enterobacter sp. TBS_079

Annotation: Hydrogenase-4 component B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 604 signal peptide" amino acids 5 to 6 (2 residues), see Phobius details transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 32 to 55 (24 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 113 to 144 (32 residues), see Phobius details amino acids 153 to 173 (21 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details amino acids 253 to 276 (24 residues), see Phobius details amino acids 288 to 308 (21 residues), see Phobius details amino acids 313 to 343 (31 residues), see Phobius details amino acids 363 to 383 (21 residues), see Phobius details amino acids 407 to 431 (25 residues), see Phobius details amino acids 451 to 476 (26 residues), see Phobius details amino acids 496 to 517 (22 residues), see Phobius details amino acids 583 to 601 (19 residues), see Phobius details PF00361: Proton_antipo_M" amino acids 135 to 404 (270 residues), 127.8 bits, see alignment E=2.5e-41

Best Hits

Swiss-Prot: 76% identical to HYCC_ECOLI: Formate hydrogenlyase subunit 3 (hycC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to enc:ECL_04062)

MetaCyc: 76% identical to hydrogenase 3 membrane subunit HycC (Escherichia coli K-12 substr. MG1655)
Ferredoxin hydrogenase. [EC: 1.12.7.2]; FHLMULTI-RXN [EC: 1.12.7.2]

Predicted SEED Role

"Formate hydrogenlyase subunit 3" in subsystem Formate hydrogenase

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.12.7.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (604 amino acids)

>MPMX20_03608 Hydrogenase-4 component B (Enterobacter sp. TBS_079)
MNAVMMITSAVAYFAAAAVLALIFSFHKTLSGWIAGIGGAVGSVMTLVAGGLVLTGGQSV
EAVMPLIRHTVEIKPLNAIWLVTFGLCGVFISLFNIDWHRHQHTQPNGLLVNLLMAAAVC
TVTASNLGALVVMAEIMALCGVFLTGCSTSGKLWFALGRLGTLLLALACWLVWQRFGTLD
FSALNGQSLGNDVWLLGVIGFGLLAGIIPLHGWVPQAHAHASAPAAALFSTVVMKVGLFG
ILTITLTGGQPPLWWGVVLLVAGMITAFVGGLYALMEHNIQRLLAYHTLENIGIILLGIG
AGVTGLALNQPALIAAGFIGGLYHLINHSLFKSTLFLGAGSVWFRTGHRDIEKLGGIGKK
MPVISLCMLVGLMAMAALPPLNGFAGEWVIYQSFFALGQSEVFIARLLGPLLAVGLAITG
ALAVMCMAKVYGVTFLGAPRTREAENACCAPALMGASVVALALCCIAGGVAAPWLLPLLG
NAIPLPLTTAHTTVSQPMIALLLIAAPLLPFVLMLFFRRDRLSSRARGTAWACGYAHEQS
MVITAHGFAMPVKENFAAVLKLRDWLNPVGWVPGWQSAAVPVLFRRLALIELAVLVVIVI
SRGA